SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000361457 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000361457
Domain Number 1 Region: 34-108
Classification Level Classification E-value
Superfamily Delta-sleep-inducing peptide immunoreactive peptide 6.15e-30
Family Delta-sleep-inducing peptide immunoreactive peptide 0.0000131
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000361457   Gene: ENSG00000157514   Transcript: ENST00000372382
Sequence length 110
Comment pep:putative chromosome:GRCh37:X:106957230:106965502:-1 gene:ENSG00000157514 transcript:ENST00000372382 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFQPPYSSSLFRKRDNASGASVVAIDNKIEQAMDLVKNHLMYAVREEVEILKEQIRELV
EKNSQLERENTLLKTLASPEQLEKFQSCLSPEEPAPESPQVPEAPGGSAV
Download sequence
Identical sequences A0A2I2ZX64 A0A2I3TFG2 A0A2J8VAS1 Q5JRJ0
ENSP00000361457 ENSGGOP00000023574 ENSP00000361457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]