SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000361581 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000361581
Domain Number 1 Region: 113-165
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.3e-21
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 2 Region: 235-292
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.52e-21
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 3 Region: 151-208
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.84e-19
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 4 Region: 198-229
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000132
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000361581   Gene: ENSG00000164011   Transcript: ENST00000372503
Sequence length 296
Comment pep:known chromosome:GRCh37:1:43315226:43317425:1 gene:ENSG00000164011 transcript:ENST00000372503 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLCSPTHSAEMSLFLQGPEEMLPLSSEGSEMGSEKEQSPEPHLPEEGEGGKPWRVDDSE
GSWIPPGEKEHGQESLSDELQETHPKKPWQKVTVRARELGDPIAHPRHEADEKPFICAQC
GKTFNNTSNLRTHQRIHTGEKPYKCSECGKSFSRSSNRIRHERIHLEEKHYKCPKCQESF
RRRSDLTTHQQDHLGKRPYRCDICGKSFSQSATLAVHHRTHLEPAPYICCECGKSFSNSS
SFGVHHRTHTGERPYECTECGRTFSDISNFGAHQRTHRGEKPYRCTVCGKHFSRSS
Download sequence
Identical sequences A0A0A0MRR1
ENSP00000361581 ENSP00000361581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]