SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000361586 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000361586
Domain Number 1 Region: 82-134
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.11e-21
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 2 Region: 218-270
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.17e-20
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 3 Region: 176-233
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.63e-19
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 4 Region: 120-177
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.98e-19
Family Classic zinc finger, C2H2 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000361586   Gene: ENSG00000164011   Transcript: ENST00000372508
Sequence length 284
Comment pep:known chromosome:GRCh37:1:43312280:43318148:1 gene:ENSG00000164011 transcript:ENST00000372508 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSEKEQSPEPHLPEEGEGGKPWRVDDSEGSWIPPGEKEHGQESLSDELQETHPKKPWQK
VTVRARELGDPIAHPRHEADEKPFICAQCGKTFNNTSNLRTHQRIHTGEKPYKCSECGKS
FSRSSNRIRHERIHLEEKHYKCPKCQESFRRRSDLTTHQQDHLGKRPYRCDICGKSFSQS
ATLAVHHRTHLEPAPYICCECGKSFSNSSSFGVHHRTHTGERPYECTECGRTFSDISNFG
AHQRTHRGEKPYRCTVCGKHFSRSSNLIRHQKTHLGEQAGKDSS
Download sequence
Identical sequences 9606.ENSP00000361584 ENSP00000361584 ENSP00000361585 ENSP00000361586 NP_056995.1.87134 NP_056995.1.92137 gi|7705692|ref|NP_056995.1| ENSP00000361584 ENSP00000361585 ENSP00000361586

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]