SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000361878 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000361878
Domain Number 1 Region: 43-240
Classification Level Classification E-value
Superfamily N-terminal domain of adenylylcyclase associated protein, CAP 1.11e-76
Family N-terminal domain of adenylylcyclase associated protein, CAP 0.0000103
Further Details:      
 
Domain Number 2 Region: 319-475
Classification Level Classification E-value
Superfamily C-terminal domain of adenylylcyclase associated protein 6.41e-66
Family C-terminal domain of adenylylcyclase associated protein 0.0000000349
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000361878   Gene: ENSG00000131236   Transcript: ENST00000372792
Sequence length 475
Comment pep:known chromosome:GRCh37:1:40506421:40537207:1 gene:ENSG00000131236 transcript:ENST00000372792 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADMQNLVERLERAVGRLEAVSHTSDMHRGYADSPSKAGAAPYVQAFDSLLAGPVAEYLK
ISKEIGGDVQKHAEMVHTGLKLERALLVTASQCQQPAENKLSDLLAPISEQIKEVITFRE
KNRGSKLFNHLSAVSESIQALGWVAMAPKPGPYVKEMNDAAMFYTNRVLKEYKDVDKKHV
DWVKAYLSIWTELQAYIKEFHTTGLAWSKTGPVAKELSGLPSGPSAGSCPPPPPPCPPPP
PVSTISCSYESASRSSLFAQINQGESITHALKHVSDDMKTHKNPALKAQSGPVRSGPKPF
SAPKPQTSPSPKRATKKEPAVLELEGKKWRVENQENVSNLVIEDTELKQVAYIYKCVNTT
LQIKGKINSITVDNCKKLGLVFDDVVGIVEIINSKDVKVQVMGKVPTISINKTDGCHAYL
SKNSLDCEIVSAKSSEMNVLIPTEGGDFNEFPVPEQFKTLWNGQKLVTTVTEIAG
Download sequence
Identical sequences Q01518
ENSP00000344832 9606.ENSP00000361878 XP_005270425.1.92137 XP_011538811.1.92137 XP_011538812.1.92137 XP_016855556.1.92137 XP_016855557.1.92137 XP_016855558.1.92137 XP_016855559.1.92137 XP_016855560.1.92137 XP_016855561.1.92137 ENSP00000361878 ENSP00000361883 ENSP00000361891 ENSP00000361878 ENSP00000361883 ENSP00000361891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]