SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000362157 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000362157
Domain Number 1 Region: 218-492
Classification Level Classification E-value
Superfamily Mitochondrial carrier 1.22e-79
Family Mitochondrial carrier 0.0000671
Further Details:      
 
Domain Number 2 Region: 70-209
Classification Level Classification E-value
Superfamily EF-hand 4.01e-24
Family Calmodulin-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000362157   Gene: ENSG00000148339   Transcript: ENST00000373066
Sequence length 501
Comment pep:known chromosome:GRCh37:9:130853743:130871524:1 gene:ENSG00000148339 transcript:ENST00000373066 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQMLWHFLASFFPRAGCHGSREGDDREVRGTPAPAWRDQMASFLGKQDGRAEATEKRPT
ILLVVGPAEQFPKKIVQAGDKDLDGQLDFEEFVHYLQDHEKKLRLVFKSLDKKNDGRIDA
QEIMQSLRDLGVKISEQQAEKILKRIRTGHFWGPVTYMDKNGTMTIDWNEWRDYHLLHPV
ENIPEIILYWKHSTIFDVGENLTVPDEFTVEERQTGMWWRHLVAGGGAGAVSRTCTAPLD
RLKVLMQVHASRSNNMGIVGGFTQMIREGGARSLWRGNGINVLKIAPESAIKFMAYEQIK
RLVGSDQETLRIHERLVAGSLAGAIAQSSIYPMEVLKTRMALRKTGQYSGMLDCARRILA
REGVAAFYKGYVPNMLGIIPYAGIDLAVYETLKNAWLQHYAVNSADPGVFVLLACGTMSS
TCGQLASYPLALVRTRMQAQASIEGAPEVTMSSLFKHILRTEGAFGLYRGLAPNFMKVIP
AVSISYVVYENLKITLGVQSR
Download sequence
Identical sequences ENSP00000362157 ENSP00000362157 NP_001252543.1.87134 NP_001252543.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]