SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000362160 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000362160
Domain Number 1 Region: 232-506
Classification Level Classification E-value
Superfamily Mitochondrial carrier 1.31e-79
Family Mitochondrial carrier 0.0000671
Further Details:      
 
Domain Number 2 Region: 44-224
Classification Level Classification E-value
Superfamily EF-hand 3.59e-35
Family Calmodulin-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000362160   Gene: ENSG00000148339   Transcript: ENST00000373069
Sequence length 515
Comment pep:known chromosome:GRCh37:9:130830572:130871524:1 gene:ENSG00000148339 transcript:ENST00000373069 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSSVLCRCVASPPPDAAATAASSSASSPASVGDPCGGAICGGPDHRLRLWRLFQTLDVN
RDGGLCVNDLAVGLRRLGLHRTEGELQKIVQAGDKDLDGQLDFEEFVHYLQDHEKKLRLV
FKSLDKKNDGRIDAQEIMQSLRDLGVKISEQQAEKILKRIRTGHFWGPVTYMDKNGTMTI
DWNEWRDYHLLHPVENIPEIILYWKHSTIFDVGENLTVPDEFTVEERQTGMWWRHLVAGG
GAGAVSRTCTAPLDRLKVLMQVHASRSNNMGIVGGFTQMIREGGARSLWRGNGINVLKIA
PESAIKFMAYEQIKRLVGSDQETLRIHERLVAGSLAGAIAQSSIYPMEVLKTRMALRKTG
QYSGMLDCARRILAREGVAAFYKGYVPNMLGIIPYAGIDLAVYETLKNAWLQHYAVNSAD
PGVFVLLACGTMSSTCGQLASYPLALVRTRMQAQASIEGAPEVTMSSLFKHILRTEGAFG
LYRGLAPNFMKVIPAVSISYVVYENLKITLGVQSR
Download sequence
Identical sequences ENSP00000362157 ENSP00000362160 XP_005251745.1.92137 ENSP00000362160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]