SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000362228 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000362228
Domain Number 1 Region: 4-100
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.37e-19
Family GDI-like N domain 0.00000929
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000362228   Gene: ENSG00000188419   Transcript: ENST00000358786
Sequence length 110
Comment pep:known chromosome:GRCh37:X:85224092:85302543:-1 gene:ENSG00000188419 transcript:ENST00000358786 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADTLPSEFDVIVIGTGLPESIIAAACSRSGRRVLHVDSRSYYGGNWASFSFSGLLSWLK
EYQENSDIVSDSPVWQDQILENEEAIALSRKDKTIQHVEVFCYARSTLLL
Download sequence
Identical sequences A0A2I2YIZ1
ENSP00000484306 gi|224028271|ref|NP_001138886.1| ENSP00000362228 NP_001138886.1.87134 NP_001138886.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]