SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000362775 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000362775
Domain Number 1 Region: 15-129
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.44e-31
Family Pyk2-associated protein beta ARF-GAP domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000362775   Gene: ENSG00000173744   Transcript: ENST00000373671
Sequence length 522
Comment pep:known chromosome:GRCh37:2:228337088:228419261:1 gene:ENSG00000173744 transcript:ENST00000373671 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASAKRKQEEKHLKMLRDMTGLPHNRKCFDCDQRGPTYVNMTVGSFVCTSCSGSLRGLN
PPHRVKSISMTTFTQQEIEFLQKHGNEVCKQIWLGLFDDRSSAIPDFRDPQKVKEFLQEK
YEKKRWYVPPEQAKVVASVHASISGSSASSTSSTPEVKPLKSLLGDSAPTLHLNKGTPSQ
SPVVGRSQGQQQEKKQFDLLSDLGSDIFAAPAPQSTATANFANFAHFNSHAGGSAASVNA
NFAHFDNFPKSSSADFGTFNTSQSHQTASAVSKVSTNKAGLQTADKYAALANLDNIFSAG
QGGDQGSGFGTTGKAPVGSVVSVPSQSSASSDKYAALAELDSVFSSAATSSNAYTSTSNA
SSNVFGTVPVVASAQTQPASSSVPAPFGATPSTNPFVAAAGPSVASSTNPFQTNARGATA
ATFGTASMSMPTGFGTPAPYSLPTSFSGSFQQPAFPAQAAFPQQTAFSQQPNGAGFAAFG
QTKPVVTPFGQVAAAGVSSNPFMTGAPTGQFPTGSSSTNPFL
Download sequence
Identical sequences NP_001128661.1.87134 NP_001128661.1.92137 ENSP00000362775 ENSP00000362775 gi|206597509|ref|NP_001128661.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]