SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000363060 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000363060
Domain Number - Region: 6-74
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.00628
Family Di-heme elbow motif 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000363060   Gene: ENSG00000009780   Transcript: ENST00000373949
Sequence length 278
Comment pep:known chromosome:GRCh37:1:28052539:28088475:1 gene:ENSG00000009780 transcript:ENST00000373949 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALYACTKCHQRFPFEALSQGQQLCKECRIAHPVVKCTYCRTEYQQESKTNTICKKCAQ
NVQLYGTPKPCQYCNIIAAFIGNKCQRCTNSEKKYGPPYSCEQCKQQCAFDRKDDRKKVD
GKLLCWLCTLSYKRVLQKTKEQRKHLSSSSRAGHQEKEQYSRLSGGGHYNSFSPDLALDS
PGTDHFVIIAQLKEEVATLKKMLHQKDQMILEKEKKITELKADFQYQESQMRAKMNQMEK
THKEVTEQLQAKNRELLKQAAALSKSKKSEKSGAITSP
Download sequence
Identical sequences A0A2I2ZL12 A0A2J8Y5U4 A0A2K5EM05 A0A2K5M512 A0A2K5RKX7 A0A2K5UD71 A0A2K6B5C9 A0A2K6KW83 A0A2K6PST8 A0A2K6THQ3 F6V7A1 F7IJP9 K6ZDY0
ENSP00000363060 NP_001137386.1.87134 NP_001137386.1.92137 XP_001111916.1.72884 XP_001149694.1.37143 XP_003921330.1.74449 XP_005544315.1.63531 XP_007978002.1.81039 XP_010378671.1.97406 XP_011761360.1.29376 XP_011935310.1.92194 XP_012295576.1.9421 XP_017390209.1.71028 XP_017711955.1.44346 XP_018872102.1.27298 gi|219881540|ref|NP_001137386.1| ENSP00000363060 ENSCJAP00000017119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]