SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000363747 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000363747
Domain Number 1 Region: 8-68
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.19e-27
Family KRAB domain (Kruppel-associated box) 0.00089
Further Details:      
 
Domain Number 2 Region: 617-674
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.52e-25
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 3 Region: 337-394
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.54e-24
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 4 Region: 393-450
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.3e-24
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Domain Number 5 Region: 562-618
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.31e-23
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 6 Region: 449-506
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.03e-23
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 7 Region: 505-562
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.19e-22
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 8 Region: 673-730
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.37e-20
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 9 Region: 715-767
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.84e-19
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 10 Region: 299-351
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000277
Family Classic zinc finger, C2H2 0.0097
Further Details:      
 
Weak hits

Sequence:  ENSP00000363747
Domain Number - Region: 140-186
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00142
Family Classic zinc finger, C2H2 0.062
Further Details:      
 
Domain Number - Region: 243-282
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0117
Family Classic zinc finger, C2H2 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000363747   Gene: ENSG00000189180   Transcript: ENST00000374618
Sequence length 811
Comment pep:known chromosome:GRCh37:10:38299578:38348991:1 gene:ENSG00000189180 transcript:ENST00000374618 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKVEQKSQESVSFKDVTVGFTQEEWQHLDPSQRALYRDVMLENYSNLVSVGYCVHKPEV
IFRLQQGEEPWKQEEEFPSQSFPEVWTADHLKERSQENQSKHLWEVVFINNEMLTKEQGD
VIGIPFNVDVSSFPSRKMFCQCDSCGMSFNTVSELVISKINYLGKKSDEFNACGKLLLNI
KHDETHTQEKNEVLKNRNTLSHHEETLQHEKIQTLEHNFEYSICQETLLEKAVFNTQKRE
NAEENNCDYNEFGRTLCDSSSLLFHQISPSRDNHYEFSDCEKFLCVKSTLSKPHGVSMKH
YDCGESGNNFRRKLCLSHLQKGDKGEKHFECNECGKAFWEKSHLTRHQRVHTGQKPFQCN
ECEKAFWDKSNLTKHQRSHTGEKPFECNECGKAFSHKSALTLHQRTHTGEKPYQCNACGK
TFCQKSDLTKHQRTHTGLKPYECYECGKSFRVTSHLKVHQRTHTGEKPFECLECGKSFSE
KSNLTQHQRIHIGDKSYECNACGKTFYHKSLLTRHQIIHTGWKPYECYECGKTFCLKSDL
TVHQRTHTGQKPFACPECGKFFSHKSTLSQHYRTHTGEKPYECHECGKIFYNKSYLTKHN
RTHTGEKPYECNECGKAFYQKSQLTQHQRIHIGEKPYKCNECGKAFCHKSALIVHQRTHT
QEKPYKCNECGKSFCVKSGLIFHERKHTGEKPYECNECGKFFRHKSSLTVHHRAHTGEKS
CQCNECGKIFYRKSELAQHQRSHTGEKPYECNTCRKTFSQKSNLIVHQRRHIGENLMNEM
DIRNFQPQVSLHNASEYSHCGESPDDILNVQ
Download sequence
Identical sequences gi|110347446|ref|NP_008885.1| NP_008885.1.87134 NP_008885.1.92137 XP_011517952.1.92137 9606.ENSP00000363747 ENSP00000363747

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]