SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000365145 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000365145
Domain Number 1 Region: 17-112
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.35e-40
Family Forkhead DNA-binding domain 0.0000125
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000365145   Gene: ENSG00000179772   Transcript: ENST00000375978
Sequence length 330
Comment pep:known chromosome:GRCh37:20:30432103:30433420:-1 gene:ENSG00000179772 transcript:ENST00000375978 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQQQPLPGPGAPTTEPTKPPYSYIALIAMAIQSSPGQRATLSGIYRYIMGRFAFYRHNRP
GWQNSIRHNLSLNECFVKVPRDDRKPGKGSYWTLDPDCHDMFEHGSFLRRRRRFTRQTGA
EGTRGPAKARRGPLRATSQDPGVPNATTGRQCSFPPELPDPKGLSFGGLVGAMPASMCPA
TTDGRPRPPMEPKEISTPKPACPGELPVATSSSSCPAFGFPAGFSEAESFNKAPTPVLSP
ESGIGSSYQCRLQALNFCMGADPGLEHLLASAAPSPAPPTPPGSLRAPLPLPTDHKEPWV
AGGFPVQGGSGYPLGLTPCLYRTPGMFFFE
Download sequence
Identical sequences O43638
ENSP00000365145 ENSP00000365145 9606.ENSP00000365145 NP_004109.1.87134 NP_004109.1.92137 gi|28973785|ref|NP_004109.1| ENSP00000365145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]