SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000373377 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000373377
Domain Number 1 Region: 75-162
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 2.32e-16
Family Double-stranded RNA-binding domain (dsRBD) 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000373377   Gene: ENSG00000164113   Transcript: ENST00000388725
Sequence length 558
Comment pep:putative chromosome:GRCh37:4:123300671:123350939:1 gene:ENSG00000164113 transcript:ENST00000388725 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKKNLPVQPATKTITTPTGWSSESYGLSKMASKVTQVTGNFPEPLLSKNLSSISNPVLP
PKKIPKEFIMKYKRGEINPVSALHQFAQMQRVQLDLKETVTTGNVMGPYFAFCAVVDGIQ
YKTGLGQNKKESRSNAAKLALDELLQLDEPEPRILETSGPPPFPAEPVVLSELAYVSKVH
YEGRHIQYAKISQIVKERFNQLISNRSEYLKYSSSLAAFIIERAGQHEVVAIGTGEYNYS
QDIKPDGRVLHDTHAVVTARRSLLRYFYRQLLLFYSKNPAMMEKSIFCTEPTSNLLTLKQ
NINICLYMNQLPKGSAQIKSQLRLNPHSISAFEANEELCLHVAVEGKIYLTVYCPKDGVN
RISSMSSSDKLTRWEVLGVQGALLSHFIQPVYISSILIGDGNCSDTRGLEIAIKQRVDDA
LTSKLPMFYLVNRPHISLVPSAYPLQMNLEYKFLSLNWAQGDVSLEIVDGLSGKITESSP
FKSGMSMASRLCKAAMLSRFNLLAKEAKKELLEAGTYHAAKCMSASYQEAKCKLKSYLQQ
HGYGSWIVKSPCIEQFNM
Download sequence
Identical sequences ENSP00000373377 NP_001152767.1.87134 NP_001152767.1.92137 gi|226530771|ref|NP_001152767.1| ENSP00000373377

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]