SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000376024 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000376024
Domain Number 1 Region: 232-363
Classification Level Classification E-value
Superfamily PX domain 3.14e-27
Family PX domain 0.002
Further Details:      
 
Domain Number 2 Region: 3-72
Classification Level Classification E-value
Superfamily SH3-domain 3.94e-16
Family SH3-domain 0.0014
Further Details:      
 
Weak hits

Sequence:  ENSP00000376024
Domain Number - Region: 389-592
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000202
Family BAR domain 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000376024   Gene: ENSG00000130340   Transcript: ENST00000392185
Sequence length 595
Comment pep:known chromosome:GRCh37:6:158244296:158366109:1 gene:ENSG00000130340 transcript:ENST00000392185 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATKARVMYDFAAEPGNNELTVNEGEIITITNPDVGGGWLEGRNIKGERGLVPTDYVEIL
PSDGKDQFSCGNSVADQAFLDSLSASTAQASSSAASNNHQVGSGNDPWSAWSASKSGNWE
SSEGWGAQPEGAGAQRNTNTPNNWDTAFGHPQAYQGPATGDDDDWDEDWDGPKSSSYFKD
SESADAGGAQRGNSRASSSSMKIPLNKFPGFAKPGTEQYLLAKQLAKPKEKIPIIVGDYG
PMWVYPTSTFDCVVADPRKGSKMYGLKSYIEYQLTPTNTNRSVNHRYKHFDWLYERLLVK
FGSAIPIPSLPDKQVTGRFEEEFIKMRMERLQAWMTRMCRHPVISESEVFQQFLNFRDEK
EWKTGKRKAERDELAGVMIFSTMEPEAPDLDLVEIEQKCEAVGKFTKAMDDGVKELLTVG
QEHWKRCTGPLPKEYQKIGKALQSLATVFSSSGYQGETDLNDAITEAGKTYEEIASLVAE
QPKKDLHFLMECNHEYKGFLGCFPDIIGTHKGAIEKVKESDKLVATSKITLQDKQNMVKR
VSIMSYALQAEMNHFHSNRIYDYNSVIRLYLEQQVQFYETIAEKLRQALSRFPVM
Download sequence
Identical sequences H2R1Q2 Q9Y5X1
gi|7706706|ref|NP_057308.1| NP_057308.1.87134 NP_057308.1.92137 XP_001144722.1.37143 ENSP00000376024 hso003010418.1 ENSPTRP00000042696 ENSP00000376024 ENSP00000252631 9598.ENSPTRP00000042696 9606.ENSP00000376024 ENSPTRP00000042696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]