SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000376268 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000376268
Domain Number 1 Region: 320-503
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 5.23e-47
Family CRAL/TRIO domain 0.0000302
Further Details:      
 
Domain Number 2 Region: 231-317
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 6.28e-23
Family CRAL/TRIO N-terminal domain 0.0013
Further Details:      
 
Domain Number 3 Region: 523-688
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 1.22e-20
Family Supernatant protein factor (SPF), C-terminal domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000376268   Gene: ENSG00000129657   Transcript: ENST00000392476
Sequence length 719
Comment pep:known chromosome:GRCh37:17:75084831:75212884:1 gene:ENSG00000129657 transcript:ENST00000392476 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVQKYQSPVRVYKYPFELIMAAYERRFPTCPLIPMFVGSDTVNEFKSEDGAIHVIERRCK
LDVDAPRLLKKIAGVDYVYFVQKNSLNSRERTLHIEAYNETFSNRVIINEHCCYTVHPEN
EDWTCFEQSASLDIKSFFGFESTVEKIAMKQYTSNIKKGKEIIEYYLRQLEEEGITFVPR
WSPPSITTSSETSSSSSKKQAASMAVVIPEAALKEGLSGDALSSPSAPEPVVGTPDDKLD
ADYIKRYLGDLTPLQESCLIRLRQWLQETHKGKIPKDEHILRFLRARDFNIDKAREIMCQ
SLTWRKQHQVDYILETWTPPQVLQDYYAGGWHHHDKDGRPLYVLRLGQMDTKGLVRALGE
EALLRYVLSINEEGLRRCEENTKVFGRPISSWTCLVDLEGLNMRHLWRPGVKALLRIIEV
VEANYPETLGRLLILRAPRVFPVLWTLVSPFIDDNTRRKFLIYAGNDYQGPGGLLDYIDK
EIIPDFLSGECMCEVPEGGLVPKSLYRTAEELENEDLKLWTETIYQSASVFKGAPHEILI
QIVDASSVITWDFDVCKGDIVFNIYHSKRSPQPPKKDSLGAHSITSPGGNNVQLIDKVWQ
LGRDYSMVESPLICKEGESVQGSHVTRWPGFYILQWKFHSMPACAASSLPRVDDVLASLQ
VSSHKCKVMYYTEVIGSEDFRGSMTSLESSHSGFSQLSAATTSSSQSHSSSMISRWRFC
Download sequence
Identical sequences ENSP00000376268 ENSP00000406030 9606.ENSP00000376268 NYSGRC-88758567 ENSP00000376268 ENSP00000406030 ENSP00000376268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]