SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000376524 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000376524
Domain Number 1 Region: 374-504
Classification Level Classification E-value
Superfamily C-type lectin-like 5.06e-34
Family C-type lectin domain 0.00077
Further Details:      
 
Domain Number 2 Region: 174-359
Classification Level Classification E-value
Superfamily C-type lectin-like 2.27e-31
Family C-type lectin domain 0.001
Further Details:      
 
Domain Number 3 Region: 807-939
Classification Level Classification E-value
Superfamily C-type lectin-like 1.52e-29
Family C-type lectin domain 0.001
Further Details:      
 
Domain Number 4 Region: 1117-1237
Classification Level Classification E-value
Superfamily C-type lectin-like 1.14e-27
Family C-type lectin domain 0.0018
Further Details:      
 
Domain Number 5 Region: 954-1100
Classification Level Classification E-value
Superfamily C-type lectin-like 3.71e-27
Family C-type lectin domain 0.0006
Further Details:      
 
Domain Number 6 Region: 659-800
Classification Level Classification E-value
Superfamily C-type lectin-like 8.15e-26
Family C-type lectin domain 0.0016
Further Details:      
 
Domain Number 7 Region: 37-162
Classification Level Classification E-value
Superfamily Ricin B-like lectins 3.96e-24
Family Cysteine rich domain 0.011
Further Details:      
 
Domain Number 8 Region: 510-646
Classification Level Classification E-value
Superfamily C-type lectin-like 4.2e-23
Family C-type lectin domain 0.0014
Further Details:      
 
Domain Number 9 Region: 1244-1321
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0000000000000219
Family C-type lectin domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000376524   Gene: ENSG00000153246   Transcript: ENST00000392771
Sequence length 1324
Comment pep:known chromosome:GRCh37:2:160802326:160919121:-1 gene:ENSG00000153246 transcript:ENST00000392771 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLSPSLLLLLLLGAPRGCAEGVAAALTPERLLEWQDKGIFVIQSESLKKCIQAGKSVLT
LENCKQANKHMLWKWVSNHGLFNIGGSGCLGLNFSAPEQPLSLYECDSTLVSLRWRCNRK
MITGPLQYSVQVAHDNTVVASRKYIHKWISYGSGGGDICEYLHKDLHTIKGNTHGMPCMF
PFQYNHQWHHECTREGREDDLLWCATTSRYERDEKWGFCPDPTSAEVGCDTIWEKDLNSH
ICYQFNLLSSLSWSEAHSSCQMQGGTLLSITDETEENFIREHMSSKTVEVWMGLNQLDEH
AGWQWSDGTPLNYLNWSPEVNFEPFVEDHCGTFSSFMPSAWRSRDCESTLPYICKKYLNH
IDHEIVEKDAWKYYATHCEPGWNPYNRNCYKLQKEEKTWHEALRSCQADNSALIDITSLA
EVEFLVTLLGDENASETWIGLSSNKIPVSFEWSNDSSVIFTNWHTLEPHIFPNRSQLCVS
AEQSEGHWKVKNCEERLFYICKKAGHVLSDAESGCQEGWERHGGFCYKIDTVLRSFDQAS
SGYYCPPALVTITNRFEQAFITSLISSVVKMKDSYFWIALQDQNDTGEYTWKPVGQKPEP
VQYTHWNTHQPRYSGGCVAMRGRHPLGRWEVKHCRHFKAMSLCKQPVENQEKAEYEERWP
FHPCYLDWESEPGLASCFKVFHSEKVLMKRTWREAEAFCEEFGAHLASFAHIEEENFVNE
LLHSKFNWTEERQFWIGFNKRNPLNAGSWEWSDRTPVVSSFLDNTYFGEDARNCAVYKAN
KTLLPLHCGSKREWICKIPRDVKPKIPFWYQYDVPWLFYQDAEYLFHTFASEWLNFEFVC
SWLHSDLLTIHSAHEQEFIHSKIKALSKYGASWWIGLQEERANDEFRWRDGTPVIYQNWD
TGRERTVNNQSQRCGFISSITGLWGSEECSVSMPSICKRKKVWLIEKKKDTPKQHGTCPK
GWLYFNYKCLLLNIPKDPSSWKNWTHAQHFCAEEGGTLVAIESEVEQAFITMNLFGQTTS
VWIGLQNDDYETWLNGKPVVYSNWSPFDIINIPSHNTTEVQKHIPLCALLSSNPNFHFTG
KWYFEDCGKEGYGFVCEKMQDTSGHGVNTSDMYPMPNTLEYGNRTYKIINANMTWYAAIK
TCLMHKAQLVSITDQYHQSFLTVVLNRLGYAHWIGLFTTDNGLNFDWSDGTKSSFTFWKD
EESSLLGDCVFADSNGRWHSTACESFLQGAICHVPPETRQSEHPELCSETSIPWIKFKSN
CYSFSTVLDSMSFEAAHEFCKKEGSNLLTIKDEAENAFLLEELFAFGSSVQMVWLNAQFD
GNSK
Download sequence
Identical sequences gi|55953106|ref|NP_001007268.1| ENSP00000376524 ENSP00000376524 NP_001007268.1.87134 NP_001007268.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]