SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000376842 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000376842
Domain Number 1 Region: 68-134
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000196
Family HLH, helix-loop-helix DNA-binding domain 0.0000963
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000376842   Gene: ENSG00000119950   Transcript: ENST00000393134
Sequence length 218
Comment pep:known chromosome:GRCh37:10:111985842:112044850:1 gene:ENSG00000119950 transcript:ENST00000393134 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERVKMINVQRLLEAAEFLERRERECEHGYASSFPSMPSPRLQHSKPPRRLSRAQKHSSG
SSNTSTANRRAHLRLCLERLKVLIPLGPDCTRHTTLGLLNKAKAHIKKLEEAERKSQHQL
ENLEREQRFLKWRLEQLQGPQEMERIRMDSIGSTISSDRSDSEREEIEVDVESTEFSHGE
VDNISTTSISDIDDHSSLPSIGSDEGYSSASVKLSFTS
Download sequence
Identical sequences B1ANN8
ENSP00000376842 ENSP00000376842

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]