SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000378330 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000378330
Domain Number 1 Region: 370-474
Classification Level Classification E-value
Superfamily SH2 domain 6.33e-26
Family SH2 domain 0.00000133
Further Details:      
 
Domain Number 2 Region: 482-523
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000000000981
Family SOCS box-like 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000378330   Gene: ENSG00000171150   Transcript: ENST00000394861
Sequence length 536
Comment pep:known chromosome:GRCh37:2:46926326:46989452:1 gene:ENSG00000171150 transcript:ENST00000394861 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDKVGKMWNNFKYRCQNLFGHEGGSRSENVDMNSNRCLSVKEKNISIGDSTPQQQSSPLR
ENIALQLGLSPSKNSSRRNQNCATEIPQIVEISIEKDNDSCVTPGTRLARRDSYSRHAPW
GGKKKHSCSTKTQSSLDADKKFGRTRSGLQRRERRYGVSSVHDMDSVSSRTVGSRSLRQR
LQDTVGLCFPMRTYSKQSKPLFSNKRKIHLSELMLEKCPFPAGSDLAQKWHLIKQHTAPV
SPHSTFFDTFDPSLVSTEDEEDRLRERRRLSIEEGVDPPPNAQIHTFEATAQVNPLYKLG
PKLAPGMTEISGDSSAIPQANCDSEEDTTTLCLQSRRQKQRQISGDSHTHVSRQGAWKVH
TQIDYIHCLVPDLLQITGNPCYWGVMDRYEAEALLEGKPEGTFLLRDSAQEDYLFSVSFR
RYNRSLHARIEQWNHNFSFDAHDPCVFHSSTVTGLLEHYKDPSSCMFFEPLLTISLNRTF
PFSLQYICRAVICRCTTYDGIDGLPLPSMLQDFLKEYHYKQKVRVRWLEREPVKAK
Download sequence
Identical sequences H2RII6 O75159
9598.ENSPTRP00000042617 9606.ENSP00000305133 ENSP00000305133 HR6385 gi|21618354|ref|NP_659198.1| gi|7662240|ref|NP_054730.1| ENSP00000305133 ENSP00000378330 ENSP00000305133 ENSP00000378330 NP_054730.1.87134 NP_054730.1.92137 NP_659198.1.87134 NP_659198.1.92137 XP_003822711.1.60992 XP_014199308.1.60992 XP_016803969.1.37143 XP_016803970.1.37143 ENSPTRP00000061344 ENSPTRP00000061344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]