SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000381773 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000381773
Domain Number 1 Region: 4-597
Classification Level Classification E-value
Superfamily Prokaryotic type I DNA topoisomerase 1.31e-158
Family Prokaryotic type I DNA topoisomerase 0.00000973
Further Details:      
 
Weak hits

Sequence:  ENSP00000381773
Domain Number - Region: 706-751
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0418
Family Cytochrome c3-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000381773   Gene: ENSG00000100038   Transcript: ENST00000398793
Sequence length 862
Comment pep:known chromosome:GRCh37:22:22311403:22337147:-1 gene:ENSG00000100038 transcript:ENST00000398793 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTVLMVAEKPSLAQSIAKILSRGSLSSHKGLNGACSVHEYTGTFAGQPVRFKMTSVCGH
VMTLDFLGKYNKWDKVDPAELFSQAPTEKKEANPKLNMVKFLQVEGRGCDYIVLWLDCDK
EGENICFEVLDAVLPVMNKAHGGEKTVFRARFSSITDTDICNAMACLGEPDHNEALSVDA
RQELDLRIGCAFTRFQTKYFQGKYGDLDSSLISFGPCQTPTLGFCVERHDKIQSFKPETY
WVLQAKVNTDKDRSLLLDWDRVRVFDREIAQMFLNMTKLEKEAQVEATSRKEKAKQRPLA
LNTVEMLRVASSSLGMGPQHAMQTAERLYTQGYISYPRTETTHYPENFDLKGSLRQQANH
PYWADTVKRLLAEGINRPRKGHDAGDHPPITPMKSATEAELGGDAWRLYEYITRHFIATV
SHDCKYLQSTISFRIGPELFTCSGKTVLSPGFTEVMPWQSVPLEESLPTCQRGDAFPVGE
VKMLEKQTNPPDYLTEAELITLMEKHGIGTDASIPVHINNICQRNYVTVESGRRLKPTNL
GIVLVHGYYKIDAELVLPTIRSAVEKQLNLIAQGKADYRQVLGHTLDVFKRKFHYFVDSI
AGMDELMEVSFSPLAATGKPLSRCGKCHRFMKYIQAKPSRLHCSHCDETYTLPQNGTIKL
YKELRCPLDDFELVLWSSGSRGKSYPLCPYCYNHPPFRDMKKGMGCNECTHPSCQHSLSM
LGIGQCVECESGVLVLDPTSGPKWKVACNKCNVVAHCFENAHRVRVSADTCSVCEAALLD
VDFNKAKSPLPGDETQHMGCVFCDPVFQELVELKHAASCHPMHRGGPGRRQGRGRGRARR
PPGKPNPRRPKDKMSALAAYFV
Download sequence
Identical sequences A0A024R1C2 G3S8S1 O95985
NYSGRC-4507635 ENSP00000349705 ENSP00000381773 NP_001269041.1.87134 NP_001269041.1.92137 NP_001269042.1.87134 NP_001269042.1.92137 NP_003926.1.87134 NP_003926.1.92137 XP_005261868.1.92137 XP_006724412.1.92137 XP_006724413.1.92137 XP_011528784.1.92137 XP_018874218.1.27298 XP_018874219.1.27298 XP_018874220.1.27298 ENSP00000349705 ENSP00000381773 ENSP00000349705 9606.ENSP00000349705 gi|4507635|ref|NP_003926.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]