SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000381823 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000381823
Domain Number 1 Region: 501-742
Classification Level Classification E-value
Superfamily vWA-like 5.06e-77
Family Trunk domain of Sec23/24 0.00000555
Further Details:      
 
Domain Number 2 Region: 695-835
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 1.83e-39
Family beta-sandwich domain of Sec23/24 0.00075
Further Details:      
 
Domain Number 3 Region: 944-1092
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 2.25e-35
Family C-terminal, gelsolin-like domain of Sec23/24 0.0009
Further Details:      
 
Domain Number 4 Region: 274-467
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 1.67e-29
Family beta-sandwich domain of Sec23/24 0.0019
Further Details:      
 
Domain Number 5 Region: 839-940
Classification Level Classification E-value
Superfamily Helical domain of Sec23/24 8.37e-26
Family Helical domain of Sec23/24 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000381823   Gene: ENSG00000113615   Transcript: ENST00000398844
Sequence length 1093
Comment pep:known chromosome:GRCh37:5:133984479:134063513:1 gene:ENSG00000113615 transcript:ENST00000398844 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQPGIPASGGAPASLQAQNGAALASGSPYTNGPVQNALLSSQESVSQGYNFQLPGSYPH
PIPAKTLNPVSGQSNYGGSQGSGQTLNRPPVASNPVTPSLHSGPAPRMPLPASQNPATTP
MPSSSFLPEANLPPPLNWQYNYPSTASQTNHCPRASSQPTVSGNTSLTTNHQYVSSGYPS
LQNSFIKSGPSVPPLVNPPLPTTFQPGAPHGPPPAGGPPPVRALTPLTSSYRDVPQPLFN
SAVNQEGITSNTNNGSMVVHSSYDEIEGGGLLATPQLTNKNPKMSRSVGYSYPSLPPGYQ
NTTPPGATGVPPSSLNYPSGPQAFTQTPLGANHLTTSMSGLSLQPEGLRVVNLLQERNML
PSTPLKPPVPNLHEDIQKLNCNPELFRCTLTSIPQTQALLNKAKLPLGLLLHPFKDLVQL
PVVTSSTIVRCRSCRTYINPFVSFLDQRRWKCNLCYRVNDVPEEFLYNPLTRVYGEPHRR
PEVQNATIEFMAPSEYMLRPPQPPVYLFVFDVSHNAVETGYLNSVCQSLLDNLDLLPGNT
RTKIGFITFDSTIHFYGLQESLSQPQMLIVSDIEDVFIPMPENLLVNLNESKELVQDLLK
TLPQMFTKTLETQSALGPALQAAFKLMSPTGGRMSVFQTQLPTLGVGALKPREEPNHRSS
AKDIHMTPSTDFYKKLALDCSGQQVAVDLFLLSGQYSDLASLGCISRYSAGSVYYYPSYH
HQHNPVQVQKLQKELQRYLTRKIGFEAVMRIRCTKGLSIHTFHGNFFVRSTDLLSLPNVN
PDAGYAVQMSVEESLTDTQLVSFQSALLYTSSKGERRIRVHTLCLPVVSTLNDVFLGADV
QAISGLLANMAVDRSMTASLSDARDALVNAVIDSLSAYRSSVLSNQQPGLMVPFSLRLFP
LFVLALLKQKSFQTGTNARLDERIFAMCQVKNQPLVYLMLTTHPSLYRVDNLSDEGALNI
SDRTIPQPPILQLSVEKLSRDGAFLMDAGSVLMLWVGKNCTQNFLSQVLGVQNYASIPQP
MTDLPELDTPESARIIAFISWLREQRPFFPILYVIRDESPMKANFLQNMIEDRTESALSY
YEFLLHIQQQVNK
Download sequence
Identical sequences O95486
gi|116174780|ref|NP_068817.1| ENSP00000381823 ENSP00000321749 9606.ENSP00000381823 ENSP00000381823 NP_068817.1.87134 NP_068817.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]