SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000383437 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000383437
Domain Number - Region: 95-121
Classification Level Classification E-value
Superfamily Ribosomal protein S18 0.0759
Family Ribosomal protein S18 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000383437   Gene: ENSG00000203624   Transcript: ENST00000400594
Sequence length 215
Comment pep:known chromosome:GRCh37:HSCHR6_MHC_QBL:30575147:30583682:1 gene:ENSG00000203624 transcript:ENST00000400594 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASVLNTVLRRLPMLSLFRGSHRVQVPLQTLCTKAPSEEDSLSSVPISPYKDEPWKYLE
SEEYQERYGSRPVWADYRRNHKGGVPPQRTRKTCINVKLLEQFVCAHTGIIFYAPYTGLL
IYHIPQVEPRDLDFSTSHGAVSATPPAPTLVSGDPWYPWYNWKQPPERELSRLRRLYQGH
LQEESGPPPESMPKMPPRTPAEASSTGQTGPQSAL
Download sequence
Identical sequences A0A0G2JIC6
ENSP00000383437 ENSP00000390930 ENSP00000397340 ENSP00000397472 ENSP00000398549 ENSP00000398781 ENSP00000383437 ENSP00000390930 ENSP00000397340 ENSP00000397472 ENSP00000398549 ENSP00000398781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]