SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000384964 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000384964
Domain Number 1 Region: 549-823
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.24e-85
Family Eukaryotic proteases 0.0001
Further Details:      
 
Domain Number 2 Region: 336-440
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000301
Family Spermadhesin, CUB domain 0.0042
Further Details:      
 
Domain Number 3 Region: 76-161
Classification Level Classification E-value
Superfamily SEA domain 0.0000000000034
Family SEA domain 0.0063
Further Details:      
 
Domain Number 4 Region: 485-516
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000249
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 5 Region: 521-560
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000367
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 6 Region: 234-318
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000209
Family Spermadhesin, CUB domain 0.0062
Further Details:      
 
Domain Number 7 Region: 450-482
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000262
Family LDL receptor-like module 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000384964   Gene: ENSG00000187045   Transcript: ENST00000406856
Sequence length 824
Comment pep:novel chromosome:GRCh37:22:37461479:37505603:-1 gene:ENSG00000187045 transcript:ENST00000406856 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVAEAPQVAGGQGDGGDGEEAEPEGMFKACEDSKRKARGYLRLVPLFVLLALLVLASAG
VLLWYFLGYKAEVMVSQVYSGSLRVLNRHFSQDLTRRESSAFRSETAKAQKMLKELITST
RLGTYYNSSSVYSFGEGPLTCFFWFILQIPEHRRLMLSPEVVQALLVEELLSTVNSSAAV
PYRAEYEVDPEGLVILEASVKDIAALNSTLGCYRYSYVGQGQVLRLKGPDHLASSCLWHL
QGPKDLMLKLRLEWTLAECRDRLAMYDVAGPLEKRLITSVYGCSRQEPVVEVLASGAIMA
VVWKKGLHSYYDPFVLSVQPVVFQACEVNLTLDNRLDSQGVLSTPYFPSYYSPQTHCSWH
LTVPSLDYGLALWFDAYALRRQKYDLPCTQGQWTIQNRRLCGLRILQPYAERIPVVATAG
ITINFTSQISLTGPGVRVHYGLYNQSDPCPGEFLCSVNGLCVPACDGVKDCPNGLDERNC
VCRATFQCKEDSTCISLPKVCDGQPDCLNGSDEEQCQEGVPCGTFTFQCEDRSCVKKPNP
QCDGRPDCRDGSDEEHCDCGLQGPSSRIVGGAVSSEGEWPWQASLQVRGRHICGGALIAD
RWVITAAHCFQEDSMASTVLWTVFLGKVWQNSRWPGEVSFKVSRLLLHPYHEEDSHDYDV
ALLQLDHPVVRSAAVRPVCLPARSHFFEPGLHCWITGWGALREGALRADAVALFYGWRNQ
GSETCCCPISNALQKVDVQLIPQDLCSEVYRYQVTPRMLCAGYRKGKKDACQGDSGGPLV
CKALSGRWFLAGLVSWGLGCGRPNYFGVYTRITGVISWIQQVVT
Download sequence
Identical sequences ENSP00000371211 ENSP00000384964 ENSP00000384964 ENSP00000371211 ENSP00000384964 NP_001275929.1.87134 NP_001275929.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]