SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000385657 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000385657
Domain Number 1 Region: 79-354
Classification Level Classification E-value
Superfamily L domain-like 1.36e-54
Family Internalin LRR domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000385657   Gene: ENSG00000115685   Transcript: ENST00000407025
Sequence length 360
Comment pep:known chromosome:GRCh37:2:242089053:242122439:1 gene:ENSG00000115685 transcript:ENST00000407025 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAERGAGQQQSQEMMEVDRRVESEESGDEEGKKHSSGIVADLSEQSLKDGEERGEEDPE
EEHELPVDMETINLDRDAEDVDLNHYRIGKIEGFEVLKKVKTLCLRQNLIKCIENLEELQ
SLRELDLYDNQIKKIENLEALTELEILDISFNLLRNIEGVDKLTRLKKLFLVNNKISKIE
NLSNLHQLQMLELGSNRIRAIENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSN
RLTKIEGLQNLVNLRELYLSHNGIEVIEGLENNNKLTMLDIASNRIKKIENISHLTELQE
FWMNDNLLESWSDLDELKGARSLETVYLERNPLQKDPQYRRKVMLALPSVRQIDATFVRF
Download sequence
Identical sequences A0A140VK83 G3RAM0 Q15435
NP_002703.1.87134 NP_002703.1.92137 XP_003813113.1.60992 XP_004033524.1.27298 ENSP00000385022 ENSP00000234038 ENSP00000385657 ENSGGOP00000012493 gi|4506013|ref|NP_002703.1| ENSGGOP00000012493 ENSP00000234038 ENSP00000385657 9606.ENSP00000234038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]