SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000385800 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000385800
Domain Number 1 Region: 194-508
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.01e-48
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0061
Further Details:      
 
Domain Number 2 Region: 77-174
Classification Level Classification E-value
Superfamily ISP domain 1.44e-26
Family Rieske iron-sulfur protein (ISP) 0.028
Further Details:      
 
Domain Number 3 Region: 512-597
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 1.79e-21
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000385800   Gene: ENSG00000183773   Transcript: ENST00000405089
Sequence length 604
Comment pep:known chromosome:GRCh37:22:21321543:21335649:1 gene:ENSG00000183773 transcript:ENST00000405089 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGCFSKPKPGAALPTVELKIEVVLPEKERGKEELSASGKGSPRAYQGNGTARHFHTEER
LSTPHPYPSPQDCVEAAVCHVKDLENGQMREVELGWGKVLLVKDNGEFHALGHKCPHYGA
PLVKGVLSRGRVRCPWHGACFNISTGDLEDFPGLDSLHKFQVKIEKEKVYVRASKQALQL
QRRTKVMAKCISPSAGYSSSTNVLIVGAGAAGLVCAETLRQEGFSDRIVLCTLDRHLPYD
RPKLSKSLDTQPEQLALRPKEFFRAYGIEVLTEAQVVTVDVRTKKVVFKDGFKLEYSKLL
LAPGSSPKTLSCKGKEVENVFTIRTPEDANRVVRLARGRNVVVVGAGFLGMEVAAYLTEK
AHSVSVVELEETPFRRFLGERVGRALMKMFENNRVKFYMQTEVSELRGQEGKLKEVVLKS
SKVVRADVCVVGIGAVPATGFLRQSGIGLDSRGFIPVNKMMQTNVPGVFAAGDAVTFPLA
WRNNRKVNIPHWQMAHAQGRVAAQNMLAQEAEMSTVPYLWTAMFGKSLRYAGYGEGFDDV
IIQGDLEELKFVAFYTKGDEVIAVASMNYDPIVSKVAEVLASGRAIRKREVETGDMSWLT
GKGS
Download sequence
Identical sequences gi|226437568|ref|NP_001139760.1| NP_001139760.1.87134 NP_001139760.1.92137 ENSP00000385800 ENSP00000385800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]