SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000386741 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000386741
Domain Number 1 Region: 264-459
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 6.47e-58
Family BCR-homology GTPase activation domain (BH-domain) 0.0000000451
Further Details:      
 
Domain Number 2 Region: 14-150
Classification Level Classification E-value
Superfamily SH2 domain 2.69e-27
Family SH2 domain 0.000000362
Further Details:      
 
Domain Number 3 Region: 197-258
Classification Level Classification E-value
Superfamily Cysteine-rich domain 4.04e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000647
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000386741   Gene: ENSG00000128656   Transcript: ENST00000409900
Sequence length 459
Comment pep:known chromosome:GRCh37:2:175664091:175869954:-1 gene:ENSG00000128656 transcript:ENST00000409900 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALTLFDTDEYRPPVWKSYLYQLQQEAPHPRRITCTCEVENRPKYYGREFHGMISREAAD
QLLIVAEGSYLIRESQRQPGTYTLALRFGSQTRNFRLYYDGKHFVGEKRFESIHDLVTDG
LITLYIETKAAEYIAKMTINPIYEHVGYTTLNREPAYKKHMPVLKETHDERDSTGQDGVS
EKRLTSLVRRATLKENEQIPKYEKIHNFKVHTFRGPHWCEYCANFMWGLIAQGVKCADCG
LNVHKQCSKMVPNDCKPDLKHVKKVYSCDLTTLVKAHTTKRPMVVDMCIREIESRGLNSE
GLYRVSGFSDLIEDVKMAFDRDGEKADISVNMYEDINIITGALKLYFRDLPIPLITYDAY
PKFIESAKIMDPDEQLETLHEALKLLPPAHCETLRYLMAHLKRVTLHEKENLMNAENLGI
VFGPTLMRSPELDAMAALNDIRYQRLVVELLIKNEDILF
Download sequence
Identical sequences G3SBI9 H2QJ06 P15882
ENSGGOP00000025465 ENSP00000295497 9606.ENSP00000386741 ENSP00000386741 NP_001813.1.87134 NP_001813.1.92137 XP_003309368.3.37143 XP_003826430.1.60992 XP_018877593.1.27298 ENSGGOP00000002145 ENSPTRP00000021634 gi|4502813|ref|NP_001813.1| ENSPTRP00000021634 ENSP00000386741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]