SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000387155 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000387155
Domain Number 1 Region: 88-131
Classification Level Classification E-value
Superfamily Orange domain-like 0.000000000314
Family Hairy Orange domain 0.0055
Further Details:      
 
Domain Number 2 Region: 22-76
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000576
Family HLH, helix-loop-helix DNA-binding domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000387155   Gene: ENSG00000144485   Transcript: ENST00000409002
Sequence length 222
Comment pep:novel chromosome:GRCh37:2:239146917:239148612:-1 gene:ENSG00000144485 transcript:ENST00000409002 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPPAAPGRDRVGREDEDGWETRGDRKARKPLVEKKRRARINESLQELRLLLAGAEAKLE
NAEVLELTVRRVQGVLRGRAREREQLQAEASERFAAGYIQCMHEVHTFVSTCQAIDATVA
AELLNHLLESMPLREGSSFQDLLGDALAGPPRAPGRSGWPAGGAPGSPIPSPPGPGDDLC
SDLEEAPEAELSQAPAEGPDLVPAALGSLTTAQIARSVWRPW
Download sequence
Identical sequences NP_001136325.1.87134 NP_001136325.1.92137 ENSP00000387155 gi|218751874|ref|NP_001136325.1| ENSP00000387155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]