SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000393865 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000393865
Domain Number 1 Region: 415-472
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.49e-23
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 2 Region: 359-416
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.15e-22
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 3 Region: 472-528
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.34e-22
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 4 Region: 275-332
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.82e-22
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 5 Region: 9-68
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.23e-21
Family KRAB domain (Kruppel-associated box) 0.0016
Further Details:      
 
Domain Number 6 Region: 513-565
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.43e-18
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 7 Region: 234-285
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000386
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 8 Region: 322-353
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000421
Family Classic zinc finger, C2H2 0.0084
Further Details:      
 
Domain Number 9 Region: 89-141
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000549
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 10 Region: 207-249
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000305
Family Classic zinc finger, C2H2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000393865   Gene: ENSG00000198466   Transcript: ENST00000423137
Sequence length 574
Comment pep:novel chromosome:GRCh37:19:58361228:58371578:1 gene:ENSG00000198466 transcript:ENST00000423137 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAVPRRPTQGTVTFEDVAVNFSQEEWCLLSEAQRCLYRDVMLENLALISSLGCWCGSK
DEEAPCKQRISVQRESQSRTPRAGVSPKKAHPCEMCGLILEDVFHFADHQETHHKQKLNR
SGACGKNLDDTAYLHQHQKQHIGEKFYRKSVREASFVKKRKLRVSQEPFVFREFGKDVLP
SSGLCQEEAAVEKTDSETMHGPPFQEGKTNYSCGKRTKAFSTKHSVIPHQKLFTRDGCYV
CSDCGKSFSRYVSFSNHQRDHTAKGPYDCGECGKSYSRKSSLIQHQRVHTGQTAYPCEEC
GKSFSQKGSLISHQLVHTGEGPYECRECGKSFGQKGNLIQHQQGHTGERAYHCGECGKSF
RQKFCFINHQRVHTGERPYKCGECGKSFGQKGNLVHHQRGHTGERPYECKECGKSFRYRS
HLTEHQRLHTGERPYNCRECGKLFNRKYHLLVHERVHTGERPYACEVCGKLFGNKHSVTI
HQRIHTGERPYECSECGKSFLSSSALHVHKRVHSGQKPYKCSECGKSFSECSSLIKHRRI
HTGERPYECTKCGKTFQRSSTLLHHQSSHRRKAL
Download sequence
Identical sequences gi|325651902|ref|NP_001191746.1| ENSP00000393865 ENSP00000393865 NP_001191746.1.87134 NP_001191746.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]