SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000394720 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000394720
Domain Number 1 Region: 48-523
Classification Level Classification E-value
Superfamily Sema domain 4.97e-164
Family Sema domain 0.00000000221
Further Details:      
 
Domain Number 2 Region: 525-578
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000000602
Family Plexin repeat 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000394720   Gene: ENSG00000185033   Transcript: ENST00000411539
Sequence length 837
Comment pep:known chromosome:GRCh37:15:90744551:90772908:1 gene:ENSG00000185033 transcript:ENST00000411539 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRTAMGLRSWLAAPWGALPPRPPLLLLLLLLLLLQPPPPTWALSPRISLPLGSEERPFL
RFEAEHISNYTALLLSRDGRTLYVGAREALFALSSNLSFLPGGEYQELLWGADAEKKQQC
SFKGKDPQRDCQNYIKILLPLSGSHLFTCGTAAFSPMCTYINMENFTLARDEKGNVLLED
GKGRCPFDPNFKSTALVVDGELYTGTVSSFQGNDPAISRSQSLRPTKTESSLNWLQDPAF
VASAYIPESLGSLQGDDDKIYFFFSETGQEFEFFENTIVSRIARICKGDEGGERVLQQRW
TSFLKAQLLCSRPDDGFPFNVLQDVFTLSPSPQDWRDTLFYGVFTSQWHRGTTEGSAVCV
FTMKDVQRVFSGLYKEVNRETQQWYTVTHPVPTPRPGACITNSARERKINSSLQLPDRVL
NFLKDHFLMDGQVRSRMLLLQPQARYQRVAVHRVPGLHHTYDVLFLGTGDGRLHKAVSVG
PRVHIIEELQIFSSGQPVQNLLLDTHRGLLYAASHSGVVQVPMANCSLYRSCGDCLLARD
PYCAWSGSSCKHVSLYQPQLATRPWIQDIEGASAKDLCSASSVVSPSFVPTGEKPCEQVQ
FQPNTVNTLACPLLSNLATRLWLRNGAPVNASASCHVLPTGDLLLVGTQQLGEFQCWSLE
EGFQQLVASYCPEVVEDGVADQTDEGGSVPVIISTSRVSAPAGGKASWGADRSYWKEFLV
MCTLFVLAVLLPVLFLLYRHRNSMKVFLKQGECASVHPKTCPVVLPPETRPLNGLGPPST
PLDHRGYQSLSDSPPGSRVFTESEKRPLSIQDSFVEVSPVCPRPRVRLGSEIRDSVV
Download sequence
Identical sequences J3KNP4
9606.ENSP00000332204 gi|39777608|ref|NP_064595.2| gi|39777610|ref|NP_945119.1| NP_064595.2.87134 NP_064595.2.92137 NP_945119.1.87134 NP_945119.1.92137 ENSP00000332204 ENSP00000332204 ENSP00000394720 ENSP00000332204 ENSP00000394720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]