SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000395201 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000395201
Domain Number 1 Region: 5-75
Classification Level Classification E-value
Superfamily PLP-dependent transferases 0.0000000000000824
Family Cystathionine synthase-like 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000395201   Gene: ENSG00000272897   Transcript: ENST00000454607
Sequence length 140
Comment pep:known chromosome:GRCh37:20:34220262:34262322:-1 gene:ENSG00000272897 transcript:ENST00000454607 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
XGESLLMALKDVALSSGSACTSASLEPSYVLRAIGTDEDLAHSSIRFGIGRFTTEEEVDY
TVEKCIQHVKRLREMSLKVGFNWLPTGLTWPLLLVKEIHLLFYQVCVVSAQHGCGHPFAR
SPNCGGDHGHSPLLLWIDHS
Download sequence
Identical sequences H7C0I5
ENSP00000395201 ENSP00000395201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]