SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000395810 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000395810
Domain Number - Region: 184-225
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0105
Family EGF-type module 0.097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000395810   Gene: ENSG00000137103   Transcript: ENST00000439587
Sequence length 338
Comment pep:known chromosome:GRCh37:9:35829225:35847232:1 gene:ENSG00000137103 transcript:ENST00000439587 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNMPQSLGNQPLPPEPPSLGTPAEGPGTTSPPEHCWPVRPTLRNELDTFSVHFYIFFGPS
VALPPERPAVFAMRLLPVLDSGGVLSLELQLNASSVRQENVTVFGCLTHEVPLSLGDAAV
TCSKESLAGFLLSVSATTRVARLRIPFPQTGTWFLALRSLCGVGPRFVRCRNATAEVRMR
TFLSPCVDDCGPYGQCKLLRTHNYLYAACECKAGWRGWGCTDSADALTYGFQLLSTLLLC
LSNLMFLPPVVLAIRSRYVLEAAVYTFTMFFSTVCGGVCILSLGACAWWWVTVCISTTFS
EGLGMSVPSLCLLQTETAVLPKLSCIDNGHFCKTHWSK
Download sequence
Identical sequences gi|27552764|ref|NP_057530.2| ENSP00000367235 ENSP00000395810 ENSP00000367235 ENSP00000395810 NP_057530.2.87134 NP_057530.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]