SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000398987 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000398987
Domain Number 1 Region: 114-286
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.6e-49
Family Ankyrin repeat 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000398987   Gene: ENSG00000163126   Transcript: ENST00000418232
Sequence length 305
Comment pep:known chromosome:GRCh37:2:97503651:97509742:-1 gene:ENSG00000163126 transcript:ENST00000418232 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFISIQQLVSGERVEGKVLGFGHGVPDPGAWPSDWRRGPQEAVAREKLKLEEEKKKKLE
RFNSTRFNLDNLADLENLVQRRKKRLRHRVPPRKPEPLVKPQSQAQVEPVGLEMFLKAAA
ENQEYLIDKYLTDGGDPNAHDKLHRTALHWACLKGHSQLVNKLLVAGATVDARDLLDRTP
VFWACRGGHLVILKQLLNQGARVNARDKIGSTPLHVAVRTRHPDCLEHLIECGAHLNAQD
KEGDTALHEAVRHGSYKAMKLLLLYGAELGVRNAASVTPVQLARDWQRGIREALQAHVAH
PRTRC
Download sequence
Identical sequences Q86SG2
ENSP00000321679 ENSP00000398987 NP_659431.5.87134 NP_659431.5.92137 ENSP00000321679 9606.ENSP00000321679 gi|41327752|ref|NP_659431.5| ENSP00000321679 ENSP00000398987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]