SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000401672 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000401672
Domain Number 1 Region: 83-357
Classification Level Classification E-value
Superfamily Mitochondrial carrier 4.84e-80
Family Mitochondrial carrier 0.0000671
Further Details:      
 
Domain Number 2 Region: 2-74
Classification Level Classification E-value
Superfamily EF-hand 0.0000000213
Family Polcalcin 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000401672   Gene: ENSG00000148339   Transcript: ENST00000433501
Sequence length 366
Comment pep:known chromosome:GRCh37:9:130860836:130871524:1 gene:ENSG00000148339 transcript:ENST00000433501 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSLRDLGVKISEQQAEKILKSMDKNGTMTIDWNEWRDYHLLHPVENIPEIILYWKHSTI
FDVGENLTVPDEFTVEERQTGMWWRHLVAGGGAGAVSRTCTAPLDRLKVLMQVHASRSNN
MGIVGGFTQMIREGGARSLWRGNGINVLKIAPESAIKFMAYEQIKRLVGSDQETLRIHER
LVAGSLAGAIAQSSIYPMEVLKTRMALRKTGQYSGMLDCARRILAREGVAAFYKGYVPNM
LGIIPYAGIDLAVYETLKNAWLQHYAVNSADPGVFVLLACGTMSSTCGQLASYPLALVRT
RMQAQASIEGAPEVTMSSLFKHILRTEGAFGLYRGLAPNFMKVIPAVSISYVVYENLKIT
LGVQSR
Download sequence
Identical sequences XP_005251746.1.92137 ENSP00000401672 gi|56699405|ref|NP_001006644.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]