SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000405436 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000405436
Domain Number 1 Region: 520-590
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 6.91e-20
Family Double-stranded RNA-binding domain (dsRBD) 0.00032
Further Details:      
 
Domain Number 2 Region: 396-467
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 7.39e-18
Family Double-stranded RNA-binding domain (dsRBD) 0.0000568
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000405436   Gene: ENSG00000129351   Transcript: ENST00000420083
Sequence length 690
Comment pep:known chromosome:GRCh37:19:10764937:10796443:1 gene:ENSG00000129351 transcript:ENST00000420083 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQA
ESDNMDVPPEDDSKEGAGEQKTEHMTRTLRGVMRVGLVAKGLLLKGDLDLELVLLCKEKP
TTALLDKVADNLAIQLAAVTEDKYEILQSVDDAAIVIKNTKEPPLSLTIHLTSPVVREEM
EKVLAGETLSVNDPPDVLDRQKCLAALASLRHAKWFQARANGLKSCVIVIRVLRDLCTRV
PTWGPLRGWPLELLCEKSIGTANRPMGAGEALRRVLECLASGIVMPDGSGIYDPCEKEAT
DAIGHLDRQQREDITQSAQHALRLAAFGQLHKVLGMDPLPSKMPKKPKNENPVDYTVQIP
PSTTYAITPMKRPMEEDGEEKSPSKKKKKIQKKEEKAEPPQAMNALMRLNQLKPGLQYKL
VSQTGPVHAPIFTMSVEVDGNSFEASGPSKKTAKLHVAVKVLQDMGLPTGAEGRDSSKGE
DSAEETEAKPAVVAPAPVVEAVSTPSAAFPSDATAEQGPILTKHGKNPVMELNEKRRGLK
YELISETGGSHDKRFVMEVEVDGQKFQGAGSNKKVAKAYAALAALEKLFPDTPLALDANK
KKRAPVPVRGGPKFAAKPHNPGFGMGGPMHNEVPPPPNLRGRGRGGSIRGRGRGRGFGGA
NHGGYMNAGAGYGSYGYGGNSATAGYTGFV
Download sequence
Identical sequences ENSP00000250241 ENSP00000250241 ENSP00000405436 gi|24234756|ref|NP_703194.1| NP_703194.1.87134 NP_703194.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]