SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000405559 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000405559
Domain Number 1 Region: 49-276,307-338
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.34e-41
Family FAD-linked reductases, N-terminal domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000405559   Gene: ENSG00000087299   Transcript: ENST00000421284
Sequence length 463
Comment pep:known chromosome:GRCh37:14:50712369:50778947:-1 gene:ENSG00000087299 transcript:ENST00000421284 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPALRYLVGACGRARGLFAGGSPGACGFASGRPRPLCGGSRSASTSSFDIVIVGGGIVG
LASARALILRHPSLSIGVLEKEKDLAVHQTGHNSGVIHSGIYYKPESLKAKLCVQGAALL
YEYCQQKGISYKQCGKLIVAVEQEEIPRLQALYEKGLQNGVPGLRLIQQEDIKKKEPYCR
GLMAIDCPHTGIVDYRQVALSFAQDFQEAGGSVLTNFEVKGIEMAKESPSRSIDGMQYPI
VIKNTKGEEIRCQYVVTCAGLYSDRISELSGCTPDPRIVPFRGDYLLLKPEKCYLVKGNI
YPVPDSRFPFLGVHFTPRMDGSIWLGPNAVLAFKREGYRPFDFSATDVMDIIINSGLIKL
ASQNFSYGVTEMYKACFLGATVKYLQKFIPEITISDILRGPAGVRAQALDRDGNLVEDFV
FDAGVGDIGNRILHVRNAPSPAATSSIAISGMIADEVQQRFEL
Download sequence
Identical sequences Q9H9P8
ENSP00000267436 ENSP00000405559 9606.ENSP00000267436 ENSP00000267436 ENSP00000405559 gi|13376331|ref|NP_079160.1| NP_079160.1.87134 NP_079160.1.92137 XP_005268132.1.92137 HR6632 ENSP00000267436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]