SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000407039 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000407039
Domain Number 1 Region: 315-372
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.53e-25
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 2 Region: 484-540
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.36e-24
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 3 Region: 427-484
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.65e-23
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 4 Region: 539-596
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.05e-23
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 5 Region: 259-316
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.29e-22
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 6 Region: 372-428
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.1e-21
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 7 Region: 637-697
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.09e-20
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 8 Region: 596-649
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.15e-20
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 9 Region: 22-76
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.29e-20
Family KRAB domain (Kruppel-associated box) 0.0017
Further Details:      
 
Domain Number 10 Region: 99-144
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000132
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 11 Region: 223-273
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000857
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000407039   Gene: ENSG00000196724   Transcript: ENST00000425570
Sequence length 697
Comment pep:putative chromosome:GRCh37:19:58433634:58446755:-1 gene:ENSG00000196724 transcript:ENST00000425570 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQEGLHRMTWDCIAIGSHENSVQGTVAFEDVAVNFSQEEWSLLSEVQRCLYHDVMLENWV
LISSLGCWCGSEDEEAPSKKSISIQRVSQVSTPGAGVSPKKAHSCEMCGAILGDILHLAD
HQGTHHKQKLHRCEAWGNKLYDSSNRPHQNQYLGEKPYRSSVEEALFVKRCKFHVSEESS
IFIQSGKDFLPSSGLLLQEATHTGEKSNSKPECESPFQWGDTHYSCGECMKHSSTKHVFV
QQQRLPSREECYCWECGKSFSKYDSVSNHQRVHTGKRPYECGECGKSFSHKGSLVQHQRV
HTGKRPYECGECGKSFSHKGSLVQHQRVHTGERPYECGECGKSFSQNGTLIKHQRVHTGE
RPYECEECGKCFTQKGNLIQHQRGHTSERPYECEECGKCFSQKGTLTEHHRVHTRERPYE
CGECGKSFSRKGHLRNHQRGHTGERPYECGECGKSFSRKGNLIQHQRSHTGERPYECREC
RKLFRGKSHLIEHQRVHTGERPYECNECGKSFQDSSGFRVHQRVHTGEKPFECSECGKSF
PQSCSLLRHRRVHTGERPYECGECGKSFHQSSSLLRHQKTHTAERPYECRECGKFFSSLL
EHRRVHTGERPYECRECGKTFTRRSAHFKHQRLHTRGKPYECSECGKSFAETFSLTEHRR
VHTGERPYECSECGKSFHRSSSLLRHQRVHTERSPYK
Download sequence
Identical sequences J3KQR4
ENSP00000407039 ENSP00000407039 ENSP00000407039 NP_001303956.1.87134 NP_001303956.1.92137 XP_016881793.1.92137 XP_016881794.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]