SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000409597 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000409597
Domain Number 1 Region: 685-742
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.54e-25
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 2 Region: 1-63
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.53e-25
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 3 Region: 405-462
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.71e-25
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 4 Region: 349-406
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.18e-25
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 5 Region: 489-546
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.28e-25
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 6 Region: 293-350
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.16e-24
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 7 Region: 629-686
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.28e-24
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 8 Region: 573-630
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.79e-24
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 9 Region: 741-798
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.76e-24
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 10 Region: 255-307
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.94e-21
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 11 Region: 452-484
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000774
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 12 Region: 536-568
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000365
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 13 Region: 789-818
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000198
Family Classic zinc finger, C2H2 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000409597   Gene: ENSG00000170949   Transcript: ENST00000418871
Sequence length 818
Comment pep:known chromosome:GRCh37:19:53569867:53606687:-1 gene:ENSG00000170949 transcript:ENST00000418871 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALTQVRLTFRDVAIEFSQEEWKCLDPAQRILYRDVMLENYWNLVSLGLCHFDMNIISML
EEGKEPWTVKSCVKIARKPRTPECVKGVVTDIPPKCTIKDLLPKEKSSTEAVFHTVVLER
HESPDIEDFSFKEPQKNVHDFECQWRDDTGNYKGVLMAQKEGKRDQRDRRDIENKLMNNQ
LGVSFHSHLPELQLFQGEGKMYECNQVEKSTNNGSSVSPLQQIPSSVQTHRSKKYHELNH
FSLLTQRRKANSCGKPYKCNECGKAFTQNSNLTSHRRIHSGEKPYKCSECGKTFTVRSNL
TIHQVIHTGEKPYKCHECGKVFRHNSYLATHRRIHTGEKPYKCNECGKAFRGHSNLTTHQ
LIHTGEKPFKCNECGKLFTQNSHLISHWRIHTGEKPYKCNECGKAFSVRSSLAIHQTIHT
GEKPYKCNECGKVFRYNSYLGRHRRVHTGEKPYKCNECGKAFSMHSNLATHQVIHTGTKP
FKCNECSKVFTQNSQLANHRRIHTGEKPYKCNECGKAFSVRSSLTTHQAIHSGEKPYKCI
ECGKSFTQKSHLRSHRGIHSGEKPYKCNECGKVFAQTSQLARHWRVHTGEKPYKCNDCGR
AFSDRSSLTFHQAIHTGEKPYKCHECGKVFRHNSYLATHRRIHTGEKPYKCNECGKAFSM
HSNLTTHKVIHTGEKPYKCNQCGKVFTQNSHLANHQRTHTGEKPYRCNECGKAFSVRSSL
TTHQAIHTGKKPYKCNECGKVFTQNAHLANHRRIHTGEKPYRCTECGKAFRVRSSLTTHM
AIHTGEKRYKCNECGKVFRQSSNLASHHRMHTGEKPYK
Download sequence
Identical sequences A0A024R4Q2 Q9HCG1
NP_001096073.1.87134 NP_001096073.1.92137 NP_001309057.1.87134 NP_001309057.1.92137 NP_001309058.1.87134 NP_001309058.1.92137 NP_001309059.1.87134 NP_001309059.1.92137 NP_001309060.1.87134 NP_001309060.1.92137 NP_001309061.1.87134 NP_001309061.1.92137 NP_001309062.1.87134 NP_001309062.1.92137 NP_001309063.1.87134 NP_001309063.1.92137 NP_001309064.1.87134 NP_001309064.1.92137 NP_001309065.1.87134 NP_001309065.1.92137 NP_150630.2.87134 NP_150630.2.92137 NP_942596.1.87134 NP_942596.1.92137 XP_016882935.1.92137 ENSP00000406201 ENSP00000409597 ENSP00000470961 ENSP00000347273 gi|156547246|ref|NP_001096073.1| gi|38788288|ref|NP_150630.2| gi|38788302|ref|NP_942596.1| ENSP00000406201 ENSP00000409597 ENSP00000470961 9606.ENSP00000270457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]