SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000410053 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000410053
Domain Number 1 Region: 206-480
Classification Level Classification E-value
Superfamily Mitochondrial carrier 1.14e-79
Family Mitochondrial carrier 0.0000671
Further Details:      
 
Domain Number 2 Region: 66-181
Classification Level Classification E-value
Superfamily EF-hand 1.23e-27
Family Calmodulin-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000410053   Gene: ENSG00000148339   Transcript: ENST00000432073
Sequence length 489
Comment pep:known chromosome:GRCh37:9:130853743:130871524:1 gene:ENSG00000148339 transcript:ENST00000432073 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQMLWHFLASFFPRAGCHGSREGDDREVRGTPAPAWRDQMASFLGKQDGRAEATEKRPT
ILLVVGPAEQFPKKIVQAGDKDLDGQLDFEEFVHYLQDHEKKLRLVFKSLDKKNDGRIDA
QEIMQSLRDLGVKISEQQAEKILKSMDKNGTMTIDWNEWRDYHLLHPVENIPEIILYWKH
STIFDVGENLTVPDEFTVEERQTGMWWRHLVAGGGAGAVSRTCTAPLDRLKVLMQVHASR
SNNMGIVGGFTQMIREGGARSLWRGNGINVLKIAPESAIKFMAYEQIKRLVGSDQETLRI
HERLVAGSLAGAIAQSSIYPMEVLKTRMALRKTGQYSGMLDCARRILAREGVAAFYKGYV
PNMLGIIPYAGIDLAVYETLKNAWLQHYAVNSADPGVFVLLACGTMSSTCGQLASYPLAL
VRTRMQAQASIEGAPEVTMSSLFKHILRTEGAFGLYRGLAPNFMKVIPAVSISYVVYENL
KITLGVQSR
Download sequence
Identical sequences NP_001006643.1.87134 NP_001006643.1.92137 ENSP00000410053 gi|56699407|ref|NP_001006643.1| ENSP00000410053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]