SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000410545 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000410545
Domain Number 1 Region: 472-529
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.29e-23
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 2 Region: 584-641
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.12e-23
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 3 Region: 752-809
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.24e-23
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 4 Region: 416-473
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.27e-22
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 5 Region: 697-753
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.3e-22
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 6 Region: 794-846
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.84e-20
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 7 Region: 10-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.22e-20
Family KRAB domain (Kruppel-associated box) 0.0017
Further Details:      
 
Domain Number 8 Region: 640-697
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.64e-20
Family Classic zinc finger, C2H2 0.0084
Further Details:      
 
Domain Number 9 Region: 528-585
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.38e-20
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 10 Region: 360-417
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.94e-19
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 11 Region: 304-361
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.34e-19
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 12 Region: 223-278
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000315
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 13 Region: 89-148
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000916
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Weak hits

Sequence:  ENSP00000410545
Domain Number - Region: 269-297
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000825
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000410545   Gene: ENSG00000204514   Transcript: ENST00000435989
Sequence length 855
Comment pep:known chromosome:GRCh37:19:58383847:58400405:-1 gene:ENSG00000204514 transcript:ENST00000435989 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAATLRLSAQGTVTFEDVAVNFTWEEWNLLSEAQRCLYRDVTLENLALISSLGCWCGV
EDEAAPSKQSIYIQRETQVRTPMAGVSPKKAHPCEMCGPILGDILHVADHQGTHHKQKLH
RCEAWGNKLYDSGNFHQHQNEHIGEKPYRGSVEEALFAKRCKLHVSGESSVFSESGKDFL
PRSGLLQQEASHTGEKSNSKTECVSPIQCGGAHYSCGESMKHFSTKHILSQHQRLLTREE
CYVCCECGKSFSKYASLSNHQRVHTEKKHECGECGKSFSKYVSFSNHQRVHTEKKHECGE
CGKSFSKYVSFSNHQRVHTGKRPYECGECGKSFSKYASFSNHQRVHTEKKHYECGECGKS
FSKYVSFSNHQRVHTGKRPYECGECGKSFSKYASFSNHQRVHTDKKHYECGECGKSFSQK
SSLIQHQRFHTGEKPYGCEECGKSFSSEGHLRSHQRVHAGERPFKCGECVKSFSHKRSLV
HHQRVHSGERPYQCGECGKSFSQKGNLVLHQRVHTGARPYECGECGKSFSSKGHLRNHQQ
IHTGDRLYECGECGKSFSHKGTLILHQRVHPRERSYGCGECGKSFSSIGHLRSHQRVHTG
ERPYECGECGKSFSHKRSLVHHQRMHTGERPYKCGDCGKSFNEKGHLRNHQRVHTTERPF
KCGECGKCFSHKGNLILHQHGHTGERPYVCRECGKLFKKKSHLLVHQRIHNGEKPYACEA
CQKFFRNKYQLIAHQRVHTGERPYECNDCGKSFTHSSTFCVHKRIHTGEKPYECSECGKS
FAESSSFTKHKRVHTGEKPYECSECGKSFAESSSLTKHKRVHTGEKPYKCEKCGKLFNKK
SHLLVHQSSHWRKAI
Download sequence
Identical sequences B7Z6K7
gi|222418585|ref|NP_001138461.1| 9606.ENSP00000410545 ENSP00000410545 NP_001138461.1.87134 NP_001138461.1.92137 ENSP00000410545 ENSP00000410545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]