SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000411687 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000411687
Domain Number 1 Region: 26-215
Classification Level Classification E-value
Superfamily Cupredoxins 1.68e-55
Family Multidomain cupredoxins 0.00000553
Further Details:      
 
Domain Number 2 Region: 225-369
Classification Level Classification E-value
Superfamily Cupredoxins 3.91e-50
Family Multidomain cupredoxins 0.00000411
Further Details:      
 
Domain Number 3 Region: 734-913
Classification Level Classification E-value
Superfamily Cupredoxins 2.22e-48
Family Multidomain cupredoxins 0.00000349
Further Details:      
 
Domain Number 4 Region: 380-574
Classification Level Classification E-value
Superfamily Cupredoxins 1.99e-47
Family Multidomain cupredoxins 0.00000588
Further Details:      
 
Domain Number 5 Region: 921-1067
Classification Level Classification E-value
Superfamily Cupredoxins 4.39e-46
Family Multidomain cupredoxins 0.000004
Further Details:      
 
Domain Number 6 Region: 577-721
Classification Level Classification E-value
Superfamily Cupredoxins 9.5e-43
Family Multidomain cupredoxins 0.0000839
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000411687   Gene: ENSG00000089472   Transcript: ENST00000441993
Sequence length 1160
Comment pep:novel chromosome:GRCh37:X:65384201:65487225:1 gene:ENSG00000089472 transcript:ENST00000441993 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWAMESGHLLWALLFMQSLWPQLTDGATRVYYLGIRDVQWNYAPKGRNVITNQPLDSDIV
ASSFLKSDKNRIGGTYKKTIYKEYKDDSYTDEVAQPAWLGFLGPVLQAEVGDVILIHLKN
FATRPYTIHPHGVFYEKDSEGSLYPDGSSGPLKADDSVPPGGSHIYNWTIPEGHAPTDAD
PACLTWIYHSHVDAPRDIATGLIGPLITCKRGALDGNSPPQRQDVDHDFFLLFSVVDENL
SWHLNENIATYCSDPASVDKEDETFQESNRMHAINGFVFGNLPELNMCAQKRVAWHLFGM
GNEIDVHTAFFHGQMLTTRGHHTDVANIFPATFVTAEMVPWEPGTWLISCQVNSHFRDGM
QALYKVKSCSMAPPVDLLTGKVRQYFIEAHEIQWDYGPMGHDGSTGKNLREPGSISDKFF
QKSSSRIGGTYWKVRYEAFQDETFQEKMHLEEDRHLGILGPVIRAEVGDTIQVVFYNRAS
QPFSMQPHGVFYEKDYEGTVYNDGSSYPGLVAKPFEKVTYRWTVPPHAGPTAQDPACLTW
MYFSAADPIRDTNSGLVGPLLVCRAGALGADGKQKGVDKEFFLLFTVLDENKSWYSNANQ
AAAMLDFRLLSEDIEGFQDSNRMHAINGFLFSNLPRLDMCKGDTVAWHLLGLGTETDVHG
VMFQGNTVQLQGMRKGAAMLFPHTFVMAIMQPDNLGTFEIYCQAGSHREAGMRAIYNVSQ
CPGHQATPRQRYQAARIYYIMAEEVEWDYCPDRSWEREWHNQSEKDSYGYIFLSNKDGLL
GSRYKKAVFREYTDGTFRIPRPRTGPEEHLGILGPLIKGEVGDILTVVFKNNASRPYSVH
AHGVLESTTVWPLAAEPGEVVTYQWNIPERSGPGPNDSACVSWIYYSAVDPIKDMYSGLV
GPLAICQKGILEPHGGRSDMDREFALLFLIFDENKSWYLEENVATHGSQDPGSINLQDET
FLESNKMHAINGKLYANLRGLTMYQGERVAWYMLAMGQDVDLHTIHFHAESFLYRNGENY
RADVVDLFPGTFEVVEMVASNPGTWLMHCHVTDHVHAGMETLFTVFSRTEHLSPLTVITK
ETEKVPPRDIEEGNVKMLGMQIPIKNVEMLASVLVAISVTLLLVVLALGGVVWYQHRQRK
LRRNRRSILDDSFKLLSFKQ
Download sequence
Identical sequences A0A0C4DG76
ENSP00000411687 NP_001124332.1.87134 NP_001124332.1.92137 gi|195947365|ref|NP_001124332.1| ENSP00000411687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]