SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000412882 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000412882
Domain Number 1 Region: 5-74
Classification Level Classification E-value
Superfamily DEATH domain 0.000000000247
Family DEATH effector domain, DED 0.017
Further Details:      
 
Domain Number 2 Region: 90-118
Classification Level Classification E-value
Superfamily DEATH domain 0.000073
Family DEATH effector domain, DED 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000412882   Gene: ENSG00000003402   Transcript: ENST00000417748
Sequence length 118
Comment pep:known chromosome:GRCh37:2:201994052:201997825:1 gene:ENSG00000003402 transcript:ENST00000417748 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAEVIHQVEEALDTDEKEMLLFLCRDVAIDVVPPNVRDLLDILRERGKLSVGDLAELLY
RVRRFDLLKRILKMDRKAVETHLLRNPHLVSDYRVLMAEIGEDLDKSDVSSLIFLMKD
Download sequence
Identical sequences A0A2J8N526 A0A2J8WV71 C9JV51
ENSP00000412882 ENSP00000412882

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]