SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000415139 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000415139
Domain Number 1 Region: 71-209
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 0.00000000000000824
Family Toll/Interleukin receptor TIR domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000415139   Gene: ENSG00000243414   Transcript: ENST00000427199
Sequence length 235
Comment pep:known chromosome:GRCh37:5:114914347:114938176:-1 gene:ENSG00000243414 transcript:ENST00000427199 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGIGKSKINSCPLSLSWGKRHSVDTSPGYHESDSKKSEDLSLCNVAEHSNTTEGPTGKQE
GAQSVEEMFEEEAEEEVFLKFVILHAEDDTDEALRVQNLLQDDFGIKPGIIFAEMPCGRQ
HLQNLDDAVNGSAWTILLLTENFLRDTWCNFQFYTSLMNSVNRQHKYNSVIPMRPLNNPL
PRERTPFALQTINALEEESRGFPTQVERIFQESVYKTQQTIWKETRNMVQRQFIA
Download sequence
Identical sequences Q86XR7
gi|33386674|ref|NP_067681.1| ENSP00000415139 NP_067681.1.87134 NP_067681.1.92137 9606.ENSP00000386341 ENSP00000415139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]