SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000415358 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000415358
Domain Number 1 Region: 208-265
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.51e-27
Family Classic zinc finger, C2H2 0.0025
Further Details:      
 
Domain Number 2 Region: 264-321
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.86e-26
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 3 Region: 320-377
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.71e-25
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 4 Region: 46-98
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.54e-21
Family KRAB domain (Kruppel-associated box) 0.0021
Further Details:      
 
Domain Number 5 Region: 377-423
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.89e-20
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 6 Region: 173-222
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000599
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000415358   Gene: ENSG00000166526   Transcript: ENST00000424697
Sequence length 446
Comment pep:known chromosome:GRCh37:7:99667597:99679371:-1 gene:ENSG00000166526 transcript:ENST00000424697 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METQADLVSQEPQALLDSALPSKVPAFSDKDSLGDEMLAAALLKAKSQELVTFEDVAVYF
IRKEWKRLEPAQRDLYRDVMLENYGNVFSLDRETRTENDQEISEDTRSHGVLLGRFQKDI
SQGLKFKEAYEREVSLKRPLGNSPGERLNRKMPDFGQVTVEEKLTPRGERSEKYNDFGNS
FTVNSNLISHQRLPVGDRPHKCDECSKSFNRTSDLIQHQRIHTGEKPYECNECGKAFSQS
SHLIQHQRIHTGEKPYECSDCGKTFSCSSALILHRRIHTGEKPYECNECGKTFSWSSTLT
HHQRIHTGEKPYACNECGKAFSRSSTLIHHQRIHTGEKPYECNECGKAFSQSSHLYQHQR
IHTGEKPYECMECGGKFTYSSGLIQHQRIHTGENPYECSECGKAFRYSSALVRHQRIHTG
EKPLNGIGMSKSSLRVTTELNIREST
Download sequence
Identical sequences A0A2I2ZTG0 P17036
ENSP00000299667 gi|122114641|ref|NP_116313.3| ENSP00000299667 ENSP00000306372 ENSP00000415358 ENSP00000299667 ENSP00000306372 ENSP00000415358 NP_001265213.1.87134 NP_001265213.1.92137 NP_001265216.1.87134 NP_001265216.1.92137 NP_001265219.1.87134 NP_001265219.1.92137 NP_001305064.1.87134 NP_001305064.1.92137 NP_116313.3.87134 NP_116313.3.92137 XP_004045918.1.27298 XP_004045920.1.27298 XP_018886269.1.27298 9606.ENSP00000299667

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]