SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000415452 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000415452
Domain Number 1 Region: 444-556
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.44e-37
Family Pyk2-associated protein beta ARF-GAP domain 0.00053
Further Details:      
 
Domain Number 2 Region: 260-321,384-429
Classification Level Classification E-value
Superfamily PH domain-like 8.52e-20
Family Pleckstrin-homology domain (PH domain) 0.009
Further Details:      
 
Domain Number 3 Region: 568-658
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.02e-16
Family Ankyrin repeat 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000415452   Gene: ENSG00000174194   Transcript: ENST00000425119
Sequence length 663
Comment pep:known chromosome:GRCh37:10:51224688:51246535:-1 gene:ENSG00000174194 transcript:ENST00000425119 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNILTCRVHPSVSLEFDQQQGSVCPSESEIYEAGAGDRMAGAPMAAAVQPAEVTVEVGE
DLHMHHVRDREMPEALEFNPSANPEASTIFQRNSQTDVVEIRRSNCTNHVSTVRFSQQYS
LCSTIFLDDSTAIQHYLTMTIISVTLEIPHHITQRDADRSLSIPDEQLHSFAVSTVHIMK
KRNGGGSLNNYSSSIPSTPSTSQEDPQFSVPPTANTPTPVCKRSMRWSNLFTSEKGSDPD
KERKAPENHADTIGSGRAIPIKQGMLLKRSGKWLKTWKKKYVTLCSNGVLTYYSSLGDYM
KNIHKKEIDLQTSTIKVPGKWPSLATSACTPISSSKSNGLSKDMDTGLGDSICFSPSISS
TTSPKLNPPPSPHANKKKHLKKKSTNNFMIVSATGQTWHFEATTYEERDAWVQAIQSQIL
ASLQSCESSKSKSQLTSQSEAMALQSIQNMRGNAHCVDCETQNPKWASLNLGVLMCIECS
GIHHSLGTRLSRVRSLELDDWPVELRKVMSSIGNDLANSIWEGSSQGQTKPSEKSTREEK
ERWIRSKYEEKLFLAPLPCTELSLGQQLLWATADEDLQTAILLLAHGSREEVNETCGEGD
GCTALHLACRKGNVVLAQLLIWYGVDVMARDAHGNTALTYARQASSQECINVLLQYGCPD
ECV
Download sequence
Identical sequences gi|117956371|ref|NP_001071154.1| ENSP00000415452 9606.ENSP00000415452 ENSP00000415452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]