SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000416805 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000416805
Domain Number 1 Region: 1-107
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.41e-27
Family D-ribulose-5-phosphate 3-epimerase 0.0000871
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000416805   Gene: ENSG00000197713   Transcript: ENST00000441588
Sequence length 107
Comment pep:putative chromosome:GRCh37:2:210867367:210882245:1 gene:ENSG00000197713 transcript:ENST00000441588 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHMMVSKPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIKPGTSVEYL
APWANQIDMALVMTVEPGFGGQKFMEDMMPKVHWLRTQFPSLDIEVD
Download sequence
Identical sequences A0A2J8N620 A0A2J8XSX9 C9JCL8
ENSP00000416805 ENSP00000416805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]