SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000419199 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000419199
Domain Number 1 Region: 55-303
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.37e-54
Family Ankyrin repeat 0.00018
Further Details:      
 
Domain Number 2 Region: 248-423
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.22e-31
Family Ankyrin repeat 0.00057
Further Details:      
 
Domain Number 3 Region: 525-576
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000000706
Family SOCS box-like 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000419199   Gene: ENSG00000239388   Transcript: ENST00000487349
Sequence length 587
Comment pep:putative chromosome:GRCh37:3:57302375:57326710:-1 gene:ENSG00000239388 transcript:ENST00000487349 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDNYTSDEDIDEDFDTQLIIQQSLQDIYKPGTAQHAPKDESLHSFLSADYKKIVETIEKG
KEDALSHLTKYHSAFGEADEIGWIPLHKAAVQLNRKILEITLSASDPSLWEQTTHNGETP
LFLAVSSCLLENATFLLLNGCNPNAKNFEGNSPLLAAVLRDCYDMAALLINYGADVNLRC
ANERTALHEAAKLGREDMVKLMLVSGAHPDPQSTYGFTPLALAAQSGHTEIMEMLLRKGA
NAHGQASDSSSILLEAASGGNPDAVALLLEYGADANIPKNSGHLPIHVAADRGHLLALKI
LIPVTDLAAIKQSGISPVHCAAAGAHPQCLELLIQAGFDVNFMLDQRINKHYDDHRKSAL
YFAVSNSDLSSVKLLLSAGALPNQDPVNCLQIALRMGNYELISLLLRHGANVNYFCRVNP
LHFPSALQYTLKDEVMLRMLLNYGYDTERCFDCPHGDKVHPSYTVEGWTSTVIKDTKFCE
VITLSWLQHLSGKVVRVMLDYVDQVRICSKLKAVLQKQGIWSEIHFILTNPRSLKHLCRL
KIRKCMGRLHLRCPVFMSFLPLPNRLKAYVLYKEYDLYGQGIFTGTW
Download sequence
Identical sequences NP_001136205.2.87134 NP_001136205.2.92137 XP_016861225.1.92137 XP_016861226.1.92137 gi|267844887|ref|NP_001136205.2| ENSP00000374252 ENSP00000419199 ENSP00000419199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]