SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000421212 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000421212
Domain Number 1 Region: 142-191
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000238
Family HkH motif-containing C2H2 finger 0.011
Further Details:      
 
Domain Number 2 Region: 98-135
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000125
Family HkH motif-containing C2H2 finger 0.0019
Further Details:      
 
Domain Number 3 Region: 44-96
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000357
Family HkH motif-containing C2H2 finger 0.002
Further Details:      
 
Domain Number 4 Region: 206-234
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000298
Family HkH motif-containing C2H2 finger 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000421212   Gene: ENSG00000113761   Transcript: ENST00000503425
Sequence length 262
Comment pep:novel chromosome:GRCh37:5:176449705:176491967:1 gene:ENSG00000113761 transcript:ENST00000503425 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEYPAPATVQAADGGAAGPYSSSELLEGQEPDGVRFDRERARRLWEAVSGAQPVGREEVE
HMIQKNQCLFTNTQCKVCCALLISESQKLAHYQSSRSKDKNQCCPICNMTFSSPVVAQSH
YLGKTHAKNLKLKQQSTKVEALHQNREMIDPDKFCSLCHATFNDPVMAQQHYVGKKHRKQ
ETKLKLMARYGRLADPAVTDFPAGKGYPCKTCKIVLNSIEQYQAHVSGFKHKNQSPKTVA
SSLGQIPMQRQPIQKDSTTLED
Download sequence
Identical sequences NP_001295143.1.87134 NP_001295143.1.92137 ENSP00000421212 ENSP00000421212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]