SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000422050 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000422050
Domain Number 1 Region: 8-57
Classification Level Classification E-value
Superfamily PLP-dependent transferases 0.0000116
Family GABA-aminotransferase-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000422050   Gene: ENSG00000164089   Transcript: ENST00000505233
Sequence length 64
Comment pep:known chromosome:GRCh37:4:109670512:109684085:-1 gene:ENSG00000164089 transcript:ENST00000505233 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MCELYSKRDTLGLRKKHIGPSCKVFFASDPIKIVRAQRQYMFDENGEQYLDCINNVAHDP
KPTT
Download sequence
Identical sequences D6R9Y3
ENSP00000422050 ENSP00000422050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]