SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000423850 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000423850
Domain Number 1 Region: 2-72
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.91e-17
Family SepSecS-like 0.000034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000423850   Gene: ENSG00000109618   Transcript: ENST00000503150
Sequence length 95
Comment pep:known chromosome:GRCh37:4:25125703:25157720:-1 gene:ENSG00000109618 transcript:ENST00000503150 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
XKYIIWPRIDQKSCFKSMITAGFEPVVIENVLEGDELRTDLKAVEAKVQELGPDCILCIH
STTSCFAPRVPDRKSFSFTFFRCPYYFIVTWIKWL
Download sequence
Identical sequences H0Y9D2
ENSP00000423850 ENSP00000423850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]