SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000424495 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000424495
Domain Number 1 Region: 199-248
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000333
Family HkH motif-containing C2H2 finger 0.011
Further Details:      
 
Domain Number 2 Region: 80-136
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000218
Family HkH motif-containing C2H2 finger 0.00083
Further Details:      
 
Domain Number 3 Region: 145-192
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000476
Family HkH motif-containing C2H2 finger 0.0019
Further Details:      
 
Domain Number 4 Region: 263-291
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000045
Family HkH motif-containing C2H2 finger 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000424495   Gene: ENSG00000113761   Transcript: ENST00000503039
Sequence length 319
Comment pep:known chromosome:GRCh37:5:176449736:176508190:1 gene:ENSG00000113761 transcript:ENST00000503039 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEYPAPATVQAADGGAAGPYSSSELLEGQEPDGVRFDRERARRLWEAVSGAQPVGREEAQ
FFPHSRTVIPILVLSETYSLCHPVEHMIQKNQCLFTNTQCKVCCALLISESQKLAHYQSK
KHANKVKRYLAIHGMETLKGETKKLDSDQKSSRSKDKNQCCPICNMTFSSPVVAQSHYLG
KTHAKNLKLKQQSTKVEALHQNREMIDPDKFCSLCHATFNDPVMAQQHYVGKKHRKQETK
LKLMARYGRLADPAVTDFPAGKGYPCKTCKIVLNSIEQYQAHVSGFKHKNQSPKTVASSL
GQIPMQRQPIQKDSTTLED
Download sequence
Identical sequences ENSP00000424495 ENSP00000261948 ENSP00000424495 NP_001295142.1.87134 NP_001295142.1.92137 ENSP00000424495

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]