SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000427065 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000427065
Domain Number 1 Region: 2-375
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.08e-105
Family GABA-aminotransferase-like 0.0000131
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000427065   Gene: ENSG00000164089   Transcript: ENST00000512646
Sequence length 441
Comment pep:putative chromosome:GRCh37:4:109663548:109684120:-1 gene:ENSG00000164089 transcript:ENST00000512646 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGHCHPGVVKAALKQMELLNTNSRFLHDNIVEYAKRLSATLPEKLSVCYFTNSGSEANDL
ALRLARQFRGHQDVITLDHAYHGHLSSLIEISPYKFQKGKDVKKEFVHVAPTPDTYRGKY
REDHADSASAYADEVKKIIEDAHNSGRKIAAFIAESMQSCGGQIIPPAGYFQKVAEYVHG
AGGVFIADEVQVGFGRVGKHFWSFQMYGEDFVPDIVTMGKPMGNGHPVACVVTTKEIAEA
FSSSGMEYFNTYGGNPVSCAVGLAVLDIIENEDLQGNAKRVGNYLTELLKKQKAKHTLIG
DIRGIGLFIGIDLVKDHLKRTPATAEAQHIIYKMKEKRVLLSADGPHRNVLKIKPPMCFT
EEDAKFMVDQLDRILTVLEEAMGTKTESVTSENTPCKTKMLKEAHIELLRDSTTDSKENP
SRKRNGMCTDTHSLLSKRLKT
Download sequence
Identical sequences gi|226442709|ref|NP_001140099.1| NP_001140099.1.87134 NP_001140099.1.92137 ENSP00000427065 ENSP00000427065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]