SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000427117 from Homo sapiens 75_37

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000427117
Domain Number - Region: 31-67
Classification Level Classification E-value
Superfamily L domain-like 0.00128
Family Ngr ectodomain-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000427117   Gene: ENSG00000186105   Transcript: ENST00000491184
Sequence length 71
Comment pep:putative chromosome:GRCh37:5:61874702:61876690:1 gene:ENSG00000186105 transcript:ENST00000491184 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCGLQFSLPCLRLFLVVTCYLLLLLHKEILGCSSVCQLCTGRQINCRNLGLSSIPKNFPE
STVFLLASKGP
Download sequence
Identical sequences A0A1D5Q908 A0A2I2YA86 A0A2I3H2W9 A0A2I3NI29 A0A2J8RL80 A0A2K5W940 A0A2K5Y7M4 A0A2K6BFT2 A0A2K6KJZ0 A0A2K6NU12 D6RD14 H2RHA1
ENSP00000427117 ENSPTRP00000060900 ENSP00000427117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]